General Information

  • ID:  hor002288
  • Uniprot ID:  Q7TSB7
  • Protein name:  Kisspeptin-10
  • Gene name:  KISS1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  KISS1 family
  • Source:  Animal
  • Expression:  Expression observed in trophoblast giant cells (TGCs), the placenta-derived cell lineage aligned at the boundary between the uterus and placenta, at 12.5 dpc. Expressions gradually decreased during placental maturation, and the signal is no more detectabl
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0031773 kisspeptin receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008285 negative regulation of cell population proliferation; GO:0030336 negative regulation of cell migration; GO:0032874 positive regulation of stress-activated MAPK cascade; GO:0033686 positive regulation of luteinizing hormone secretion; GO:0043410 positive regulation of MAPK cascade; GO:0046697 decidualization; GO:0050806 positive regulation of synaptic transmission; GO:0060112 generation of ovulation cycle rhythm; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016324 apical plasma membrane; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  YNWNSFGLRY
  • Length:  10(110-119)
  • Propeptide:  MISLASWQLLLLLCVASFGEPLAKMAPVVNPEPTGQQSGPQELVNAWQKGPRYAESKPGAAGLRARRTSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQREKDMSAYNWNSFGLRYGRRQVARAARG
  • Signal peptide:  MISLASWQLLLLLCVASFG
  • Modification:  T1 Phosphotyrosine;T10 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Metastasis suppressor protein. May regulate events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide, metastin which functions as the endogenous ligand of the G-protein coupled rec
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Kiss1r
  • Target Unid:   Q924U1
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7TSB7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002288_AF2.pdbhor002288_ESM.pdb

Physical Information

Mass: 148014 Formula: C63H82N16O16
Absent amino acids: ACDEHIKMPQTV Common amino acids: NY
pI: 9.17 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 3
Hydrophobicity: -96 Boman Index: -2071
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 39
Instability Index: 2179 Extinction Coefficient cystines: 8480
Absorbance 280nm: 942.22

Literature

  • PubMed ID:  NA
  • Title:  NA